Product Number |
ARP58004_P050 |
Product Page |
www.avivasysbio.com/grm6-antibody-n-terminal-region-arp58004-p050.html |
Name |
GRM6 Antibody - N-terminal region (ARP58004_P050) |
Protein Size (# AA) |
877 amino acids |
Molecular Weight |
95kDa |
NCBI Gene Id |
2916 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glutamate receptor, metabotropic 6 |
Alias Symbols |
mGlu6, CSNB1B, GPRC1F, MGLUR6 |
Peptide Sequence |
Synthetic peptide located within the following region: AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nielsen,D.A., (2008) Mol. Psychiatry 13 (4), 417-428 |
Description of Target |
L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. |
Protein Interactions |
GNAO1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GRM6 (ARP58004_P050) antibody |
Blocking Peptide |
For anti-GRM6 (ARP58004_P050) antibody is Catalog # AAP58004 (Previous Catalog # AAPP32427) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GRM6 |
Uniprot ID |
O15303 |
Protein Name |
Metabotropic glutamate receptor 6 |
Protein Accession # |
NP_000834 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000843 |
Tested Species Reactivity |
Human |
Gene Symbol |
GRM6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 79%; Zebrafish: 79% |
Image 1 | Human 721_B
| WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysate |
|