GRM6 Antibody - N-terminal region (ARP58004_P050)

Data Sheet
 
Product Number ARP58004_P050
Product Page www.avivasysbio.com/grm6-antibody-n-terminal-region-arp58004-p050.html
Name GRM6 Antibody - N-terminal region (ARP58004_P050)
Protein Size (# AA) 877 amino acids
Molecular Weight 95kDa
NCBI Gene Id 2916
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glutamate receptor, metabotropic 6
Alias Symbols mGlu6, CSNB1B, GPRC1F, MGLUR6
Peptide Sequence Synthetic peptide located within the following region: AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nielsen,D.A., (2008) Mol. Psychiatry 13 (4), 417-428
Description of Target L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.
Protein Interactions GNAO1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRM6 (ARP58004_P050) antibody
Blocking Peptide For anti-GRM6 (ARP58004_P050) antibody is Catalog # AAP58004 (Previous Catalog # AAPP32427)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRM6
Uniprot ID O15303
Protein Name Metabotropic glutamate receptor 6
Protein Accession # NP_000834
Purification Affinity Purified
Nucleotide Accession # NM_000843
Tested Species Reactivity Human
Gene Symbol GRM6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 79%; Zebrafish: 79%
Image 1
Human 721_B
WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com