GPS1 Antibody - N-terminal region (ARP58000_P050)

Data Sheet
 
Product Number ARP58000_P050
Product Page www.avivasysbio.com/gps1-antibody-n-terminal-region-arp58000-p050.html
Name GPS1 Antibody - N-terminal region (ARP58000_P050)
Protein Size (# AA) 491 amino acids
Molecular Weight 55kDa
Subunit 1
NCBI Gene Id 2873
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name G protein pathway suppressor 1
Alias Symbols CSN1, SGN1, COPS1
Peptide Sequence Synthetic peptide located within the following region: PLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target This protein is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. It shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions COPS2; COPS3; COPS4; COPS7A; COPS5; COPS6; COPS8; UBC; cul1; PRKAR2A; FBXO6; NFKBIA; FBXW4; SENP8; vpr; IRF5; NOTCH1; COPS7B; DDB2; DCUN1D1; ASB4; NOD1; CUL2; CUL3; CUL4A; CUL4B; CUL5; NEDD8; JUN; ITPK1; GFER; ERCC8; TP53; POLR2A; DDB1; PSMA6; NF2; CARD11
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GPS1 (ARP58000_P050) antibody
Blocking Peptide For anti-GPS1 (ARP58000_P050) antibody is Catalog # AAP58000 (Previous Catalog # AAPP32423)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GPS1
Uniprot ID Q13098
Protein Name COP9 signalosome complex subunit 1
Protein Accession # NP_004118
Purification Affinity Purified
Nucleotide Accession # NM_004127
Tested Species Reactivity Human
Gene Symbol GPS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human COLO205
WB Suggested Anti-GPS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com