TRIM58 Antibody - middle region (ARP57993_P050)

• Product Number: ARP57993_P050
• Name: TRIM58 Antibody - middle region (ARP57993_P050)
• Protein Size (# AA): 486 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 25893
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tripartite motif containing 58
• Alias Symbols: BIA2
• Peptide Sequence: Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Description of Target: The specific function of the protein remains unknown.
• Protein Interactions: DYNC2LI1; TRIM58; UBE2D3; UBC; DYNC1LI2; DYNC1I1; DYNC1H1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM58 (ARP57993_P050) antibody is Catalog # AAP57993 (Previous Catalog # AAPP32416)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM58
• Uniprot ID: Q8NG06
• Protein Name: Tripartite motif-containing protein 58
• Protein Accession #: NP_056246
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015431
• Tested Species Reactivity: Human
• Gene Symbol: TRIM58
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-TRIM58 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate
• Image 2: Human Placenta, Human Brain
  
  Host: Rabbit
  Target: TRIM58
  Positive control (+): Human Placenta (PL)
  Negative control (-): Human Brain (BR)
  Antibody concentration: 1ug/ml