| Product Number |
ARP57989_P050 |
| Product Page |
www.avivasysbio.com/c22orf31-antibody-middle-region-arp57989-p050.html |
| Name |
C22orf31 Antibody - middle region (ARP57989_P050) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
25770 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 22 open reading frame 31 |
| Alias Symbols |
HS747E2A, bK747E2.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C22orf31 (ARP57989_P050) antibody |
| Blocking Peptide |
For anti-C22orf31 (ARP57989_P050) antibody is Catalog # AAP57989 (Previous Catalog # AAPP32412) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C22orf31 |
| Uniprot ID |
O95567 |
| Protein Name |
Uncharacterized protein C22orf31 |
| Protein Accession # |
NP_056185 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015370 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C22orf31 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Small Intestine
 | WB Suggested Anti-C22orf31 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Small Intestine |
|
|
