| Product Number |
ARP57984_P050 |
| Product Page |
www.avivasysbio.com/zhx3-antibody-middle-region-arp57984-p050.html |
| Name |
ZHX3 Antibody - middle region (ARP57984_P050) |
| Protein Size (# AA) |
956 amino acids |
| Molecular Weight |
105kDa |
| NCBI Gene Id |
23051 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc fingers and homeoboxes 3 |
| Alias Symbols |
TIX1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Liu,G., (2006) J. Biol. Chem. 281 (51), 39681-39692 |
| Description of Target |
This protein is a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. |
| Protein Interactions |
NLK; ATXN1; TFAP4; ZHX2; ZHX1; ZHX3; NFYA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZHX3 (ARP57984_P050) antibody |
| Blocking Peptide |
For anti-ZHX3 (ARP57984_P050) antibody is Catalog # AAP57984 (Previous Catalog # AAPP32395) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZHX3 |
| Uniprot ID |
Q9H4I2 |
| Protein Name |
Zinc fingers and homeoboxes protein 3 |
| Protein Accession # |
NP_055850 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015035 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZHX3 |
| Predicted Species Reactivity |
Human, Rat, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 86%; Human: 100%; Rabbit: 92%; Rat: 86% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZHX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
|
