| Product Number |
ARP57981_P050 |
| Product Page |
www.avivasysbio.com/foxl1-antibody-middle-region-arp57981-p050.html |
| Name |
FOXL1 Antibody - middle region (ARP57981_P050) |
| Protein Size (# AA) |
345 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
2300 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box L1 |
| Alias Symbols |
FKH6, FKHL11, FREAC7 |
| Peptide Sequence |
Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hassel,S., (2004) Proteomics 4 (5), 1346-1358 |
| Description of Target |
The exact function of FOXL1 remains unknown. |
| Protein Interactions |
BMPR2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXL1 (ARP57981_P050) antibody |
| Blocking Peptide |
For anti-FOXL1 (ARP57981_P050) antibody is Catalog # AAP57981 (Previous Catalog # AAPP32392) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOXL1 |
| Uniprot ID |
Q12952 |
| Protein Name |
Forkhead box protein L1 |
| Protein Accession # |
NP_005241 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005250 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXL1 |
| Predicted Species Reactivity |
Human, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Human: 100%; Pig: 93% |
| Image 1 | Human Heart
 | WB Suggested Anti-FOXL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart |
|
|
