| Product Number |
ARP57972_P050 |
| Product Page |
www.avivasysbio.com/evx1-antibody-middle-region-arp57972-p050.html |
| Name |
EVX1 Antibody - middle region (ARP57972_P050) |
| Protein Size (# AA) |
407 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
2128 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Even-skipped homeobox 1 |
| Alias Symbols |
EVX-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Briata,P., (1995) J. Biol. Chem. 270 (46), 27695-27701 |
| Description of Target |
EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943 |
| Protein Interactions |
RAD21; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EVX1 (ARP57972_P050) antibody |
| Blocking Peptide |
For anti-EVX1 (ARP57972_P050) antibody is Catalog # AAP57972 (Previous Catalog # AAPP32383) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EVX1 |
| Uniprot ID |
P49640 |
| Protein Name |
Homeobox even-skipped homolog protein 1 |
| Protein Accession # |
NP_001980 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001989 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EVX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 75%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Rat: 86% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-EVX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate |
|
|
