EVX1 Antibody - middle region (ARP57972_P050)

Data Sheet
 
Product Number ARP57972_P050
Product Page www.avivasysbio.com/evx1-antibody-middle-region-arp57972-p050.html
Name EVX1 Antibody - middle region (ARP57972_P050)
Protein Size (# AA) 407 amino acids
Molecular Weight 42kDa
NCBI Gene Id 2128
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Even-skipped homeobox 1
Alias Symbols EVX-1
Peptide Sequence Synthetic peptide located within the following region: GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Briata,P., (1995) J. Biol. Chem. 270 (46), 27695-27701
Description of Target EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943
Protein Interactions RAD21;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EVX1 (ARP57972_P050) antibody
Blocking Peptide For anti-EVX1 (ARP57972_P050) antibody is Catalog # AAP57972 (Previous Catalog # AAPP32383)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EVX1
Uniprot ID P49640
Protein Name Homeobox even-skipped homolog protein 1
Protein Accession # NP_001980
Purification Affinity Purified
Nucleotide Accession # NM_001989
Tested Species Reactivity Human
Gene Symbol EVX1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 75%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Rat: 86%
Image 1
Human MCF-7
WB Suggested Anti-EVX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com