Product Number |
ARP57958_P050 |
Product Page |
www.avivasysbio.com/znf358-antibody-n-terminal-region-arp57958-p050.html |
Name |
ZNF358 Antibody - N-terminal region (ARP57958_P050) |
Protein Size (# AA) |
568 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
140467 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
zinc finger protein 358 |
Alias Symbols |
ZFEND |
Peptide Sequence |
Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ZNF358 may be involved in transcriptional regulation. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF358 (ARP57958_P050) antibody |
Blocking Peptide |
For anti-ZNF358 (ARP57958_P050) antibody is Catalog # AAP57958 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF358 |
Uniprot ID |
Q9NW07 |
Protein Name |
Zinc finger protein 358 |
Protein Accession # |
XP_005272517 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF358 |
Predicted Species Reactivity |
Human, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 85%; Human: 100% |
Image 1 | Human Esophagus Tumor
| Host: Rabbit Target Name: ZNF358 Sample Tissue: Human Esophagus Tumor Antibody Dilution: 1ug/ml |
|
|