ZNF358 Antibody - N-terminal region (ARP57958_P050)

Data Sheet
 
Product Number ARP57958_P050
Product Page www.avivasysbio.com/znf358-antibody-n-terminal-region-arp57958-p050.html
Name ZNF358 Antibody - N-terminal region (ARP57958_P050)
Protein Size (# AA) 568 amino acids
Molecular Weight 62kDa
NCBI Gene Id 140467
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name zinc finger protein 358
Alias Symbols ZFEND
Peptide Sequence Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ZNF358 may be involved in transcriptional regulation.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF358 (ARP57958_P050) antibody
Blocking Peptide For anti-ZNF358 (ARP57958_P050) antibody is Catalog # AAP57958
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF358
Uniprot ID Q9NW07
Protein Name Zinc finger protein 358
Protein Accession # XP_005272517
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol ZNF358
Predicted Species Reactivity Human, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 85%; Human: 100%
Image 1
Human Esophagus Tumor
Host: Rabbit
Target Name: ZNF358
Sample Tissue: Human Esophagus Tumor
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com