| Product Number |
ARP57952_P050 |
| Product Page |
www.avivasysbio.com/klf8-antibody-n-terminal-region-arp57952-p050.html |
| Name |
KLF8 Antibody - N-terminal region (ARP57952_P050) |
| Protein Size (# AA) |
359 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
11279 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kruppel-like factor 8 |
| Alias Symbols |
BKLF3, ZNF741 |
| Peptide Sequence |
Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,X., (2007) Cancer Res. 67 (15), 7184-7193 |
| Description of Target |
KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation. |
| Protein Interactions |
Dlg4; APP; UBC; XPO1; PARP1; KAT2B; EP300; CREBBP; FHL3; CTBP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLF8 (ARP57952_P050) antibody |
| Blocking Peptide |
For anti-KLF8 (ARP57952_P050) antibody is Catalog # AAP57952 (Previous Catalog # AAPP32363) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8 |
| Uniprot ID |
O95600 |
| Protein Name |
Krueppel-like factor 8 |
| Protein Accession # |
NP_009181 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007250 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLF8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Pig: 90%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Placenta
 | WB Suggested Anti-KLF8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta |
|
|
