TRIM31 Antibody - middle region (ARP57948_P050)

Data Sheet
 
Product Number ARP57948_P050
Product Page www.avivasysbio.com/trim31-antibody-middle-region-arp57948-p050.html
Name TRIM31 Antibody - middle region (ARP57948_P050)
Protein Size (# AA) 425 amino acids
Molecular Weight 48kDa
NCBI Gene Id 11074
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tripartite motif containing 31
Alias Symbols RNF, HCG1, HCGI, C6orf13
Peptide Sequence Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shiina,T., (2006) Genetics 173 (3), 1555-1570
Description of Target TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.
Protein Interactions MAGEA2B; MAGEA1; USP7; MKRN3; TRIM27; MNAT1; UBE2E2; UBE2D3; UBE2D2; UBE2D1; ZSCAN1; IKBKG; UBE2W; UBE2D4; UBE2K; TRIM31; TRAF2; TRIM23;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM31 (ARP57948_P050) antibody
Blocking Peptide For anti-TRIM31 (ARP57948_P050) antibody is Catalog # AAP57948 (Previous Catalog # AAPP32359)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIM31
Uniprot ID Q9BZY9
Protein Name E3 ubiquitin-protein ligase TRIM31
Protein Accession # NP_008959
Purification Affinity Purified
Nucleotide Accession # NM_007028
Tested Species Reactivity Human
Gene Symbol TRIM31
Predicted Species Reactivity Human, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rabbit: 91%
Image 1
Human Lung
WB Suggested Anti-TRIM31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com