TRIM31 Antibody - middle region (ARP57947_P050)

Data Sheet
 
Product Number ARP57947_P050
Product Page www.avivasysbio.com/trim31-antibody-middle-region-arp57947-p050.html
Name TRIM31 Antibody - middle region (ARP57947_P050)
Protein Size (# AA) 425 amino acids
Molecular Weight 48 kDa
NCBI Gene Id 11074
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tripartite motif containing 31
Alias Symbols RNF, HCG1, HCGI, C6orf13
Peptide Sequence Synthetic peptide located within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Collins,J.E., Genome Biol. 5 (10), R84 (2004)
Description of Target TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus.
Protein Interactions MAGEA2B; MAGEA1; USP7; MKRN3; TRIM27; MNAT1; UBE2E2; UBE2D3; UBE2D2; UBE2D1; ZSCAN1; IKBKG; UBE2W; UBE2D4; UBE2K; TRIM31; TRAF2; TRIM23;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM31 (ARP57947_P050) antibody
Blocking Peptide For anti-TRIM31 (ARP57947_P050) antibody is Catalog # AAP57947 (Previous Catalog # AAPP32358)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIM31
Uniprot ID Q9BZY9
Protein Name E3 ubiquitin-protein ligase TRIM31
Protein Accession # NP_008959
Purification Affinity Purified
Nucleotide Accession # NM_001098535
Tested Species Reactivity Human
Gene Symbol TRIM31
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Small Intestine
WB Suggested Anti-TRIM31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com