| Product Number |
ARP57945_P050 |
| Product Page |
https://www.avivasysbio.com/rfpl3-antibody-middle-region-arp57945-p050.html |
| Name |
RFPL3 Antibody - middle region (ARP57945_P050) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
10738 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ret finger protein-like 3 |
| Alias Symbols |
RNF120 |
| Peptide Sequence |
Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
LNX1; UBE2I; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RFPL3 (ARP57945_P050) antibody |
| Blocking Peptide |
For anti-RFPL3 (ARP57945_P050) antibody is Catalog # AAP57945 (Previous Catalog # AAPP32356) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RFPL3 |
| Uniprot ID |
O75679 |
| Protein Name |
Ret finger protein-like 3 |
| Protein Accession # |
NP_001092005 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004852 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RFPL3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human COLO205
 | WB Suggested Anti-RFPL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate |
|
|
