MED16 Antibody - C-terminal region : Biotin (ARP57927_P050-Biotin)

Data Sheet
 
Product Number ARP57927_P050-Biotin
Product Page www.avivasysbio.com/med16-antibody-c-terminal-region-biotin-arp57927-p050-biotin.html
Name MED16 Antibody - C-terminal region : Biotin (ARP57927_P050-Biotin)
Protein Size (# AA) 877 amino acids
Molecular Weight 97kDa
Subunit 16
Conjugation Biotin
NCBI Gene Id 10025
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mediator complex subunit 16
Alias Symbols DRIP92, THRAP5, TRAP95
Peptide Sequence Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Sato,S., (2004) Mol. Cell 14 (5), 685-691
Description of Target THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Protein Interactions HECW2; CDK19; CDK8; UBC; MED19; MED26; EPAS1; FBXW7; MED11; MED8; MED29; MED9; MED18; MED4; RALY; MED13; MED12; MED24; MED21; MED14; MED1; CTDP1; HIST1H3A; MED10; MED25; MED15; VDR; TRA; MED28; OBFC1; ZC3H13; QKI; TADA2A; SUPT7L; SUPT3H; MYC; KAT2A; TRRAP
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MED16 (ARP57927_P050-Biotin) antibody
Blocking Peptide For anti-MED16 (ARP57927_P050-Biotin) antibody is Catalog # AAP57927 (Previous Catalog # AAPP32338)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MED16
Uniprot ID Q9Y2X0
Protein Name Mediator of RNA polymerase II transcription subunit 16
Protein Accession # NP_005472
Purification Affinity Purified
Nucleotide Accession # NM_005481
Gene Symbol MED16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com