MED16 Antibody - C-terminal region (ARP57927_P050)

Data Sheet
 
Product Number ARP57927_P050
Product Page www.avivasysbio.com/med16-antibody-c-terminal-region-arp57927-p050.html
Name MED16 Antibody - C-terminal region (ARP57927_P050)
Protein Size (# AA) 877 amino acids
Molecular Weight 97kDa
Subunit 16
NCBI Gene Id 10025
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mediator complex subunit 16
Alias Symbols DRIP92, THRAP5, TRAP95
Peptide Sequence Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sato,S., (2004) Mol. Cell 14 (5), 685-691
Description of Target THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Protein Interactions HECW2; CDK19; CDK8; UBC; MED19; MED26; EPAS1; FBXW7; MED11; MED8; MED29; MED9; MED18; MED4; RALY; MED13; MED12; MED24; MED21; MED14; MED1; CTDP1; HIST1H3A; MED10; MED25; MED15; VDR; TRA; MED28; OBFC1; ZC3H13; QKI; TADA2A; SUPT7L; SUPT3H; MYC; KAT2A; TRRAP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MED16 (ARP57927_P050) antibody
Blocking Peptide For anti-MED16 (ARP57927_P050) antibody is Catalog # AAP57927 (Previous Catalog # AAPP32338)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MED16
Uniprot ID Q9Y2X0
Protein Name Mediator of RNA polymerase II transcription subunit 16
Protein Accession # NP_005472
Purification Affinity Purified
Nucleotide Accession # NM_005481
Tested Species Reactivity Human
Gene Symbol MED16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Image 1
Human Placenta
WB Suggested Anti-MED16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com