| Product Number |
ARP57926_P050 |
| Product Page |
www.avivasysbio.com/onecut2-antibody-middle-region-arp57926-p050.html |
| Name |
ONECUT2 Antibody - middle region (ARP57926_P050) |
| Protein Size (# AA) |
504 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
9480 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
One cut homeobox 2 |
| Alias Symbols |
OC2, OC-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125 |
| Description of Target |
ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT |
| Protein Interactions |
KDM5B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ONECUT2 (ARP57926_P050) antibody |
| Blocking Peptide |
For anti-ONECUT2 (ARP57926_P050) antibody is Catalog # AAP57926 (Previous Catalog # AAPP32337) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2 |
| Uniprot ID |
O95948 |
| Protein Name |
One cut domain family member 2 |
| Sample Type Confirmation |
ONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_004843 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014216 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ONECUT2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human NCI-H226
 | WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
|
