Product Number |
ARP57920_P050 |
Product Page |
www.avivasysbio.com/taf1c-antibody-n-terminal-region-arp57920-p050.html |
Name |
TAF1C Antibody - N-terminal region (ARP57920_P050) |
Protein Size (# AA) |
869 amino acids |
Molecular Weight |
95kDa |
Subunit |
C |
NCBI Gene Id |
9013 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa |
Alias Symbols |
SL1, TAFI95, TAFI110, MGC:39976 |
Peptide Sequence |
Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Friedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558 |
Description of Target |
Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. |
Protein Interactions |
UBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TAF1C (ARP57920_P050) antibody |
Blocking Peptide |
For anti-TAF1C (ARP57920_P050) antibody is Catalog # AAP57920 (Previous Catalog # AAPP32331) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C |
Uniprot ID |
Q15572 |
Protein Name |
TATA box-binding protein-associated factor RNA polymerase I subunit C |
Sample Type Confirmation |
TAF1C is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_005670 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005679 |
Tested Species Reactivity |
Human |
Gene Symbol |
TAF1C |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-TAF1C Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateTAF1C is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|