TAF1C Antibody - N-terminal region (ARP57920_P050)

Data Sheet
 
Product Number ARP57920_P050
Product Page www.avivasysbio.com/taf1c-antibody-n-terminal-region-arp57920-p050.html
Name TAF1C Antibody - N-terminal region (ARP57920_P050)
Protein Size (# AA) 869 amino acids
Molecular Weight 95kDa
Subunit C
NCBI Gene Id 9013
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Alias Symbols SL1, TAFI95, TAFI110, MGC:39976
Peptide Sequence Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Friedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558
Description of Target Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
Protein Interactions UBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAF1C (ARP57920_P050) antibody
Blocking Peptide For anti-TAF1C (ARP57920_P050) antibody is Catalog # AAP57920 (Previous Catalog # AAPP32331)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C
Uniprot ID Q15572
Protein Name TATA box-binding protein-associated factor RNA polymerase I subunit C
Sample Type Confirmation

TAF1C is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005670
Purification Affinity Purified
Nucleotide Accession # NM_005679
Tested Species Reactivity Human
Gene Symbol TAF1C
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-TAF1C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateTAF1C is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com