TAF1C Antibody - N-terminal region (ARP57920_P050)

• Product Number: ARP57920_P050
• Name: TAF1C Antibody - N-terminal region (ARP57920_P050)
• Protein Size (# AA): 869 amino acids
• Molecular Weight: 95kDa
• Subunit: C
• NCBI Gene Id: 9013
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
• Alias Symbols: SL1, TAFI95, TAFI110, MGC:39976
• Peptide Sequence: Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Friedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558
• Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
• Protein Interactions: UBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TAF1C (ARP57920_P050) antibody is Catalog # AAP57920 (Previous Catalog # AAPP32331)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C
• Uniprot ID: Q15572
• Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit C
• Sample Type Confirmation:

  TAF1C is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_005670
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005679
• Tested Species Reactivity: Human
• Gene Symbol: TAF1C
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TAF1C Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysateTAF1C is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells