| Product Number |
ARP57907_P050 |
| Product Page |
www.avivasysbio.com/tfap2b-antibody-n-terminal-region-arp57907-p050.html |
| Name |
TFAP2B Antibody - N-terminal region (ARP57907_P050) |
| Protein Size (# AA) |
460 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
7021 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor AP-2 beta (activating enhancer binding protein 2 beta) |
| Alias Symbols |
PDA2, AP-2B, AP2-B, AP-2beta |
| Peptide Sequence |
Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71 |
| Description of Target |
TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c |
| Protein Interactions |
YEATS4; UBC; KCTD1; UBE2I; SUMO1; SSBP4; LZTR1; VPS11; HIST1H2AC; CITED4; MYC; CITED2; CITED1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFAP2B (ARP57907_P050) antibody |
| Blocking Peptide |
For anti-TFAP2B (ARP57907_P050) antibody is Catalog # AAP57907 (Previous Catalog # AAPP32318) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B |
| Uniprot ID |
Q92481 |
| Protein Name |
Transcription factor AP-2-beta |
| Protein Accession # |
NP_003212 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003221 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFAP2B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-TFAP2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
