TBX2 Antibody - N-terminal region (ARP57903_P050)

Data Sheet
 
Product Number ARP57903_P050
Product Page https://www.avivasysbio.com/tbx2-antibody-n-terminal-region-arp57903-p050.html
Name TBX2 Antibody - N-terminal region (ARP57903_P050)
Protein Size (# AA) 702 amino acids
Molecular Weight 74kDa
NCBI Gene Id 6909
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box 2
Alias Symbols VETD
Peptide Sequence Synthetic peptide located within the following region: EAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Abrahams,A., (2008) J. Biol. Chem. 283 (4), 2223-2230
Description of Target This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX2 is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions SOX2; SUMO1; EGR1; LZTR1; CEBPE; NKX2-5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBX2 (ARP57903_P050) antibody
Blocking Peptide For anti-TBX2 (ARP57903_P050) antibody is Catalog # AAP57903 (Previous Catalog # AAPP32314)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBX2
Uniprot ID Q13207
Protein Name T-box transcription factor TBX2
Protein Accession # NP_005985
Purification Affinity Purified
Nucleotide Accession # NM_005994
Tested Species Reactivity Human
Gene Symbol TBX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 86%; Zebrafish: 93%
Image 1
Human Liver
WB Suggested Anti-TBX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver