Product Number |
ARP57903_P050 |
Product Page |
www.avivasysbio.com/tbx2-antibody-n-terminal-region-arp57903-p050.html |
Name |
TBX2 Antibody - N-terminal region (ARP57903_P050) |
Protein Size (# AA) |
702 amino acids |
Molecular Weight |
74kDa |
NCBI Gene Id |
6909 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box 2 |
Alias Symbols |
VETD |
Peptide Sequence |
Synthetic peptide located within the following region: EAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Abrahams,A., (2008) J. Biol. Chem. 283 (4), 2223-2230 |
Description of Target |
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX2 is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
SOX2; SUMO1; EGR1; LZTR1; CEBPE; NKX2-5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX2 (ARP57903_P050) antibody |
Blocking Peptide |
For anti-TBX2 (ARP57903_P050) antibody is Catalog # AAP57903 (Previous Catalog # AAPP32314) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX2 |
Uniprot ID |
Q13207 |
Protein Name |
T-box transcription factor TBX2 |
Protein Accession # |
NP_005985 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005994 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 86%; Zebrafish: 93% |
Image 1 | Human Liver
| WB Suggested Anti-TBX2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Liver |
|
|