| Product Number |
ARP57899_P050 |
| Product Page |
www.avivasysbio.com/sox15-antibody-n-terminal-region-arp57899-p050.html |
| Name |
SOX15 Antibody - N-terminal region (ARP57899_P050) |
| Protein Size (# AA) |
233 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
6665 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 15 |
| Alias Symbols |
SOX20, SOX26, SOX27 |
| Peptide Sequence |
Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yan,H.T., (2007) Mol. Cells 24 (3), 323-328 |
| Description of Target |
SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
| Protein Interactions |
HSFY1; BHLHE40; HOXB9; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX15 (ARP57899_P050) antibody |
| Blocking Peptide |
For anti-SOX15 (ARP57899_P050) antibody is Catalog # AAP57899 (Previous Catalog # AAPP32310) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15 |
| Uniprot ID |
O60248 |
| Protein Name |
Protein SOX-15 |
| Protein Accession # |
NP_008873 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006942 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SOX15 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Pig: 92% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-SOX15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
|
