MRPS15 Antibody - middle region (ARP57897_P050)

Data Sheet
 
Product Number ARP57897_P050
Product Page www.avivasysbio.com/mrps15-antibody-middle-region-arp57897-p050.html
Name MRPS15 Antibody - middle region (ARP57897_P050)
Protein Size (# AA) 257 amino acids
Molecular Weight 30kDa
NCBI Gene Id 64960
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mitochondrial ribosomal protein S15
Alias Symbols DC37, S15mt, RPMS15, MPR-S15
Peptide Sequence Synthetic peptide located within the following region: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,Z. (2003) Genomics 81 (5), 468-480
Description of Target MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family. The protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the protein is the least conserved among small subunit ribosomal proteins.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Protein Interactions GRSF1; UBC; PARK2; ESR2; PTCD3; CAND1; COPS5; CUL3; SUMO2; ICT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MRPS15 (ARP57897_P050) antibody
Blocking Peptide For anti-MRPS15 (ARP57897_P050) antibody is Catalog # AAP57897 (Previous Catalog # AAPP32308)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MRPS15
Uniprot ID P82914
Protein Name 28S ribosomal protein S15, mitochondrial
Protein Accession # NP_112570
Purification Affinity Purified
Nucleotide Accession # NM_031280
Tested Species Reactivity Human
Gene Symbol MRPS15
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 83%; Rat: 79%
Image 1
Human Liver
WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com