| Product Number |
ARP57876_P050 |
| Product Page |
www.avivasysbio.com/nhlh1-antibody-middle-region-arp57876-p050.html |
| Name |
NHLH1 Antibody - middle region (ARP57876_P050) |
| Protein Size (# AA) |
133 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
4807 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nescient helix loop helix 1 |
| Alias Symbols |
HEN1, NSCL, NSCL1, bHLHa35 |
| Peptide Sequence |
Synthetic peptide located within the following region: AKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Manetopoulos,C., (2003) Biochem. Biophys. Res. Commun. 307 (4), 891-899 |
| Description of Target |
NHLH1 may serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. |
| Protein Interactions |
CENPP; PIM1; INO80E; PSME2; HIVEP1; ELAVL1; LMO4; CSRP3; LMO1; LMO2; xlmo1; TCF3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NHLH1 (ARP57876_P050) antibody |
| Blocking Peptide |
For anti-NHLH1 (ARP57876_P050) antibody is Catalog # AAP57876 (Previous Catalog # AAPP32229) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NHLH1 |
| Uniprot ID |
Q02575 |
| Protein Name |
Helix-loop-helix protein 1 |
| Protein Accession # |
NP_005589 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005598 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NHLH1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-NHLH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain |
|
