| Product Number |
ARP57870_P050 |
| Product Page |
www.avivasysbio.com/hoxd1-antibody-middle-region-arp57870-p050.html |
| Name |
HOXD1 Antibody - middle region (ARP57870_P050) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
3231 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox D1 |
| Alias Symbols |
HOX4, HOX4G, Hox-4.7 |
| Peptide Sequence |
Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kosaki,K., (2002) Teratology 65 (2), 50-62 |
| Description of Target |
HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene |
| Protein Interactions |
HOXC9; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXD1 (ARP57870_P050) antibody |
| Blocking Peptide |
For anti-HOXD1 (ARP57870_P050) antibody is Catalog # AAP57870 (Previous Catalog # AAPP32223) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXD1 |
| Uniprot ID |
Q9GZZ0 |
| Protein Name |
Homeobox protein Hox-D1 |
| Protein Accession # |
NP_078777 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024501 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXD1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Stomach
 | WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach |
|
|
