GABPB2 Antibody - N-terminal region (ARP57863_P050)

Data Sheet
 
Product Number ARP57863_P050
Product Page www.avivasysbio.com/gabpb2-antibody-n-terminal-region-arp57863-p050.html
Name GABPB2 Antibody - N-terminal region (ARP57863_P050)
Protein Size (# AA) 360 amino acids
Molecular Weight 38kDa
Subunit beta-1
NCBI Gene Id 2553
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GA binding protein transcription factor, beta subunit 1
Alias Symbols E4TF1, GABPB, BABPB2, E4TF1B, GABPB2, NRF2B1, NRF2B2, GABPB-1, E4TF1-47, E4TF1-53
Peptide Sequence Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Crook,M.F., (2008) FASEB J. 22 (1), 225-235
Description of Target GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Protein Interactions FAM90A1; RBM11; RSPH14; TDRD7; POGZ; LMO4; TRAF2; SNRPB2; SNRPA; LMO1; UBC; MAGEB18; RYBP; YAF2; YY1; GABPA; IL16; DHX16; CIC; LMO3; USO1; FANCG; BAI2; HCFC1; ATF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABPB1 (ARP57863_P050) antibody
Blocking Peptide For anti-GABPB1 (ARP57863_P050) antibody is Catalog # AAP57863 (Previous Catalog # AAPP32216)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABPB2
Uniprot ID Q06547
Protein Name GA-binding protein subunit beta-1
Protein Accession # NP_002032
Purification Affinity Purified
Nucleotide Accession # NM_002041
Tested Species Reactivity Human
Gene Symbol GABPB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Transfected 293T
WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com