TRIM10 Antibody - C-terminal region (ARP57848_P050)

• Product Number: ARP57848_P050
• Name: TRIM10 Antibody - C-terminal region (ARP57848_P050)
• Protein Size (# AA): 481 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 10107
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tripartite motif containing 10
• Alias Symbols: RNF9, HERF1, RFB30
• Peptide Sequence: Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570
• Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms.
• Protein Interactions: TTC23; ZNF148; PSMA1; PRKAB2; HSP90AA1; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TRIM10;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM10 (ARP57848_P050) antibody is Catalog # AAP57848 (Previous Catalog # AAPP32201)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10
• Uniprot ID: Q9UDY6
• Protein Name: Tripartite motif-containing protein 10
• Protein Accession #: NP_006769
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006778
• Tested Species Reactivity: Human
• Gene Symbol: TRIM10
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 92%; Guinea Pig: 83%; Horse: 77%; Human: 100%; Mouse: 85%; Pig: 85%; Rat: 85%
• Image 1: Human heart
  
  WB Suggested Anti-TRIM10 antibody Titration: 1 ug/mL
  Sample Type: Human heart
• Image 2: Human HeLa
  
  WB Suggested Anti-TRIM10 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Hela cell lysate