PH-4 Antibody - middle region (ARP57763_P050)

Data Sheet
 
Product Number ARP57763_P050
Product Page www.avivasysbio.com/ph-4-antibody-middle-region-arp57763-p050.html
Name PH-4 Antibody - middle region (ARP57763_P050)
Protein Size (# AA) 502 amino acids
Molecular Weight 57kDa
NCBI Gene Id 54681
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum)
Alias Symbols PH4, PH-4, PHD4, EGLN4, HIDEA, HIFPH4, P4H-TM
Peptide Sequence Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552
Description of Target The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m
Protein Interactions GLP1R; PDIA2; nef; UBC; CD1D;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-P4HTM (ARP57763_P050) antibody
Blocking Peptide For anti-P4HTM (ARP57763_P050) antibody is Catalog # AAP57763 (Previous Catalog # AAPP38820)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PH-4
Uniprot ID Q9NXG6
Protein Name Transmembrane prolyl 4-hydroxylase
Protein Accession # NP_808808
Purification Affinity Purified
Nucleotide Accession # NM_177939
Tested Species Reactivity Human
Gene Symbol P4HTM
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HT1080
WB Suggested Anti-PH-4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com