Product Number |
ARP57763_P050 |
Product Page |
www.avivasysbio.com/ph-4-antibody-middle-region-arp57763-p050.html |
Name |
PH-4 Antibody - middle region (ARP57763_P050) |
Protein Size (# AA) |
502 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
54681 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum) |
Alias Symbols |
PH4, PH-4, PHD4, EGLN4, HIDEA, HIFPH4, P4H-TM |
Peptide Sequence |
Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552 |
Description of Target |
The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m |
Protein Interactions |
GLP1R; PDIA2; nef; UBC; CD1D; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-P4HTM (ARP57763_P050) antibody |
Blocking Peptide |
For anti-P4HTM (ARP57763_P050) antibody is Catalog # AAP57763 (Previous Catalog # AAPP38820) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PH-4 |
Uniprot ID |
Q9NXG6 |
Protein Name |
Transmembrane prolyl 4-hydroxylase |
Protein Accession # |
NP_808808 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_177939 |
Tested Species Reactivity |
Human |
Gene Symbol |
P4HTM |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HT1080
| WB Suggested Anti-PH-4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: HT1080 cell lysate |
|