MAGEB1 Antibody - middle region (ARP57757_P050)

• Name: MAGEB1 Antibody - middle region (ARP57757_P050)
• Protein Size (# AA): 347 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 4112
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Melanoma antigen family B, 1
• Alias Symbols: CT3.1, DAM10, MAGEL1, MAGE-Xp
• Peptide Sequence: Synthetic peptide located within the following region: EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337
• Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
• Protein Interactions: SRPK2; SRPK1; EID3; EID2; NSMCE4A; UBC; NEDD4L;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MAGEB1 (ARP57757_P050) antibody is Catalog # AAP57757 (Previous Catalog # AAPP38814)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAGEB1
• Uniprot ID: P43366
• Protein Name: Melanoma-associated antigen B1
• Protein Accession #: NP_803134
• Purification: Affinity Purified
• Nucleotide Accession #: NM_177415
• Tested Species Reactivity: Human
• Gene Symbol: MAGEB1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Stomach
  
  WB Suggested Anti-MAGEB1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Stomach