MAGEB1 Antibody - middle region (ARP57757_P050)

Data Sheet
 
Product Number ARP57757_P050
Product Page https://www.avivasysbio.com/mageb1-antibody-middle-region-arp57757-p050.html
Name MAGEB1 Antibody - middle region (ARP57757_P050)
Protein Size (# AA) 347 amino acids
Molecular Weight 39kDa
NCBI Gene Id 4112
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Melanoma antigen family B, 1
Alias Symbols CT3.1, DAM10, MAGEL1, MAGE-Xp
Peptide Sequence Synthetic peptide located within the following region: EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ross,M.T., (2005) Nature 434 (7031), 325-337
Description of Target This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
Protein Interactions SRPK2; SRPK1; EID3; EID2; NSMCE4A; UBC; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MAGEB1 (ARP57757_P050) antibody
Blocking Peptide For anti-MAGEB1 (ARP57757_P050) antibody is Catalog # AAP57757 (Previous Catalog # AAPP38814)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MAGEB1
Uniprot ID P43366
Protein Name Melanoma-associated antigen B1
Protein Accession # NP_803134
Purification Affinity Purified
Nucleotide Accession # NM_177415
Tested Species Reactivity Human
Gene Symbol MAGEB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-MAGEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach