| Product Number |
ARP57756_P050 |
| Product Page |
www.avivasysbio.com/mageb1-antibody-middle-region-arp57756-p050.html |
| Name |
MAGEB1 Antibody - middle region (ARP57756_P050) |
| Protein Size (# AA) |
347 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
4112 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Melanoma antigen family B, 1 |
| Alias Symbols |
CT3.1, DAM10, MAGEL1, MAGE-Xp |
| Peptide Sequence |
Synthetic peptide located within the following region: QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ross,M.T., (2005) Nature 434 (7031), 325-337 |
| Description of Target |
This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen |
| Protein Interactions |
SRPK2; SRPK1; EID3; EID2; NSMCE4A; UBC; NEDD4L; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MAGEB1 (ARP57756_P050) antibody |
| Blocking Peptide |
For anti-MAGEB1 (ARP57756_P050) antibody is Catalog # AAP57756 (Previous Catalog # AAPP38813) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MAGEB1 |
| Uniprot ID |
P43366 |
| Protein Name |
Melanoma-associated antigen B1 |
| Sample Type Confirmation |
MAGEB1 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_803134 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_177415 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MAGEB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 77%; Guinea Pig: 82%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 82% |
| Image 1 | Human Brain
 | WB Suggested Anti-MAGEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain |
|
| Image 2 | Human 721_B
 | Host: Rabbit
Target Name: MAGEB1
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlMAGEB1 is supported by BioGPS gene expression data to be expressed in 721_B |
|
