MFN1 Antibody - middle region (ARP57702_P050)

• Product Number: ARP57702_P050
• Name: MFN1 Antibody - middle region (ARP57702_P050)
• Protein Size (# AA): 741 amino acids
• Molecular Weight: 84 kDa
• NCBI Gene Id: 55669
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitofusin 1
• Alias Symbols: hfzo1, hfzo2
• Peptide Sequence: Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
• Protein Interactions: PARK2; MARCH5; UBC; TER94; MAVS; CCNB1; ILF2; BAK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MFN1 (ARP57702_P050) antibody is Catalog # AAP57702 (Previous Catalog # AAPP42948)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFN1
• Uniprot ID: Q8R4Z9
• Protein Name: Mitofusin-1
• Publications:

  Bonala, S. et al. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Mol. Endocrinol. 27, 1518-35 (2013). 23927930

  Papanicolaou, K. N. et al. Mitofusin-2 maintains mitochondrial structure and contributes to stress-induced permeability transition in cardiac myocytes. Mol. Cell. Biol. 31, 1309-28 (2011). 21245373

• Protein Accession #: NP_284941
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033540
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: MFN1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse Kidney
  
  Host: Mouse
  Target Name: MFN1
  Sample Tissue: Mouse Kidney
  Antibody Dilution: 1ug/ml
• Image 2: Human Placenta
  
  WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Placenta