Product Number |
ARP57702_P050 |
Product Page |
www.avivasysbio.com/mfn1-antibody-middle-region-arp57702-p050.html |
Name |
MFN1 Antibody - middle region (ARP57702_P050) |
Protein Size (# AA) |
741 amino acids |
Molecular Weight |
84 kDa |
NCBI Gene Id |
55669 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Mitofusin 1 |
Alias Symbols |
hfzo1, hfzo2 |
Peptide Sequence |
Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. |
Protein Interactions |
PARK2; MARCH5; UBC; TER94; MAVS; CCNB1; ILF2; BAK1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-MFN1 (ARP57702_P050) antibody |
Blocking Peptide |
For anti-MFN1 (ARP57702_P050) antibody is Catalog # AAP57702 (Previous Catalog # AAPP42948) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MFN1 |
Uniprot ID |
Q8R4Z9 |
Protein Name |
Mitofusin-1 |
Publications |
Bonala, S. et al. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Mol. Endocrinol. 27, 1518-35 (2013). 23927930
Papanicolaou, K. N. et al. Mitofusin-2 maintains mitochondrial structure and contributes to stress-induced permeability transition in cardiac myocytes. Mol. Cell. Biol. 31, 1309-28 (2011). 21245373 |
Protein Accession # |
NP_284941 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_033540 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
MFN1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Kidney
| Host: Mouse Target Name: MFN1 Sample Tissue: Mouse Kidney Antibody Dilution: 1ug/ml |
| Image 2 | Human Placenta
| WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Placenta |
|
|