| Product Number |
ARP57667_P050 |
| Product Page |
www.avivasysbio.com/matn2-antibody-middle-region-arp57667-p050.html |
| Name |
MATN2 Antibody - middle region (ARP57667_P050) |
| Protein Size (# AA) |
937 amino acids |
| Molecular Weight |
107 kDa |
| NCBI Gene Id |
4147 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Matrilin 2 |
| Description |
|
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ichikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000 |
| Description of Target |
MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
DVL3; CBFA2T3; ATXN1L; ATXN1; ATXN7; CACNA1A; MATN4; MATN2; COL4A6; COL4A5; FN1; FBN2; COL1A1; COL4A4; COL4A1; COL4A2; COL4A3; MATN1; MATN3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MATN2 (ARP57667_P050) antibody |
| Blocking Peptide |
For anti-MATN2 (ARP57667_P050) antibody is Catalog # AAP57667 (Previous Catalog # AAPP35443) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MATN2 |
| Uniprot ID |
A8K106 |
| Protein Name |
Matrilin-2 |
| Publications |
Extracellular matrix changes in corneal opacification vary depending on etiology. Mol Vis. 27, 26-36 (2021). 33633437
Szalai, E. et al. Fibrillin-2, tenascin-C, matrilin-2, and matrilin-4 are strongly expressed in the epithelium of human granular and lattice type I corneal dystrophies. Mol. Vis. 18, 1927-36 (2012). 22876117 |
| Protein Accession # |
NP_085072 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_030583 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MATN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 82% |
| Image 1 | Human Lung
 | WB Suggested Anti-MATN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1ug/mL of the antibody was used in this experiment.
|
|
