MTRR Antibody - N-terminal region (ARP57657_P050)

• Product Number: ARP57657_P050
• Name: MTRR Antibody - N-terminal region (ARP57657_P050)
• Protein Size (# AA): 725 amino acids
• Molecular Weight: 80kDa
• NCBI Gene Id: 4552
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
• Alias Symbols: MSR, cblE
• Peptide Sequence: Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
• Protein Interactions: GMCL1; PAPSS1; HIST1H2AG; FH; ELAVL1; UBC; MMAB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MTRR (ARP57657_P050) antibody is Catalog # AAP57657 (Previous Catalog # AAPP42044)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR
• Uniprot ID: Q9UBK8
• Protein Name: Methionine synthase reductase
• Publications:

  Richard, E., Desviat, L. R., Ugarte, M. & Pérez, B. Oxidative stress and apoptosis in homocystinuria patients with genetic remethylation defects. J. Cell. Biochem. 114, 183-91 (2013). 22887477

• Sample Type Confirmation:

  MTRR is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_076915
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024010
• Tested Species Reactivity: Human
• Gene Symbol: MTRR
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-MTRR Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human HeLa
  
  WB Suggested Anti-MTRR Antibody Titration: 1ug/ml
  Positive Control: Hela cell lysate
• Image 3: Human HeLa
  
  Host: Rabbit
  Target Name: MTRR
  Sample Type: Hela
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5.0 ug/ml
  Lysate Quantity: 25ug/lane/lane
  Gel Concentration: 12%MTRR is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
• Image 4: Human heart
  
  Rabbit Anti-MTRR Antibody
  Catalog Number: ARP57657_P050
  Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: N/A
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec