MMP26 Antibody - C-terminal region (ARP57558_P050)

• Product Number: ARP57558_P050
• Name: MMP26 Antibody - C-terminal region (ARP57558_P050)
• Protein Size (# AA): 261 amino acids
• Molecular Weight: 19kDa
• NCBI Gene Id: 56547
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Matrix metallopeptidase 26
• Alias Symbols: MGC126590, MGC126592
• Peptide Sequence: Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain.
• Protein Interactions: SERPINA1; IGFBP1; MMP9;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MMP26 (ARP57558_P050) antibody is Catalog # AAP57558 (Previous Catalog # AAPP44656)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP26
• Uniprot ID: Q9NRE1
• Protein Name: Matrix metalloproteinase-26
• Sample Type Confirmation:

  MMP26 is supported by BioGPS gene expression data to be expressed in A549

• Protein Accession #: NP_068573
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021801
• Tested Species Reactivity: Human
• Gene Symbol: MMP26
• Predicted Species Reactivity: Human, Rat
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rat: 83%
• Image 1: Human A549
  
  WB Suggested Anti-MMP26 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: A549 cell lysateMMP26 is supported by BioGPS gene expression data to be expressed in A549