| Product Number |
ARP57549_P050 |
| Product Page |
www.avivasysbio.com/gnb4-antibody-middle-region-arp57549-p050.html |
| Name |
GNB4 Antibody - middle region (ARP57549_P050) |
| Protein Size (# AA) |
340 amino acids |
| Molecular Weight |
37kDa |
| Subunit |
beta1-4 |
| NCBI Gene Id |
59345 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanine nucleotide binding protein (G protein), beta polypeptide 4 |
| Alias Symbols |
CMTD1F |
| Peptide Sequence |
Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. |
| Protein Interactions |
UBC; SUMO2; GNG8; GNG12; GNG2; GNG13; GNGT1; GNG11; GNG10; GNG7; GNG5; GNG4; GNG3; FBXO6; CDK18; ADRB2; PAN2; MTNR1A; ESR1; GNAI3; GNAI2; GNAI1; PDCL; CEP97; RGS6; Haus1; Haus4; Mau2; Trim69; Cdk1; MTNR1B; GNGT2; git11; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GNB4 (ARP57549_P050) antibody |
| Specificity |
Gene Symbol:GNB1,GNB2,GNB3
Protein Accession#:NP_002065,NP_005264,NP_002066
Nucleotide Accession#:NM_002074,NM_005273,NM_002075
Swissprot ID:P62873,P62879,P16520
|
| Blocking Peptide |
For anti-GNB4 (ARP57549_P050) antibody is Catalog # AAP57549 (Previous Catalog # AAPP43035) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GNB4 |
| Uniprot ID |
Q9HAV0 |
| Protein Name |
Guanine nucleotide-binding protein subunit beta-4 |
| Protein Accession # |
NP_067642 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021629 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GNB4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HCT15
 | WB Suggested Anti-GNB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HCT15 cell lysate |
|
| Image 2 | Human HEK293
 | GNB4 antibody - middle region (ARP57549_P050) validated by WB using HEK293 cell lysate |
|
