| Product Number |
ARP57516_P050 |
| Product Page |
www.avivasysbio.com/ppp3cb-antibody-c-terminal-region-arp57516-p050.html |
| Name |
Ppp3cb Antibody - C-terminal region (ARP57516_P050) |
| Protein Size (# AA) |
525 amino acids |
| Molecular Weight |
58kDa |
| Subunit |
beta isoform |
| NCBI Gene Id |
19056 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein phosphatase 3, catalytic subunit, beta isoform |
| Alias Symbols |
Ca, Cn, Cnab, Calnb, CnAbeta, 1110063J16Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. |
| Protein Interactions |
CALM1; Ywhaz; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ppp3cb (ARP57516_P050) antibody |
| Blocking Peptide |
For anti-Ppp3cb (ARP57516_P050) antibody is Catalog # AAP57516 (Previous Catalog # AAPP41630) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P48453 |
| Protein Name |
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform |
| Protein Accession # |
NP_032940 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_008914 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ppp3cb |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Ppp3cb Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
