| Product Number |
ARP57451_P050 |
| Product Page |
www.avivasysbio.com/pdp2-antibody-middle-region-arp57451-p050.html |
| Name |
PDP2 Antibody - middle region (ARP57451_P050) |
| Protein Size (# AA) |
529 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
57546 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pyruvate dehyrogenase phosphatase catalytic subunit 2 |
| Alias Symbols |
PPM2B, PDPC 2, PPM2C2 |
| Peptide Sequence |
Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex. |
| Protein Interactions |
UBC; PRKCD; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PDP2 (ARP57451_P050) antibody |
| Blocking Peptide |
For anti-PDP2 (ARP57451_P050) antibody is Catalog # AAP57451 (Previous Catalog # AAPP41445) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PDP2 |
| Uniprot ID |
Q9P2J9 |
| Protein Name |
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial |
| Protein Accession # |
NP_065837 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020786 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PDP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PDP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
