KCTD16 Antibody - N-terminal region (ARP57447_P050)

Data Sheet
 
Product Number ARP57447_P050
Product Page www.avivasysbio.com/kctd16-antibody-n-terminal-region-arp57447-p050.html
Name KCTD16 Antibody - N-terminal region (ARP57447_P050)
Protein Size (# AA) 428 amino acids
Molecular Weight 49kDa
NCBI Gene Id 57528
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Potassium channel tetramerisation domain containing 16
Alias Symbols DKFZp781A1155, KIAA1317, MGC138167
Peptide Sequence Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCTD16 (ARP57447_P050) antibody
Blocking Peptide For anti-KCTD16 (ARP57447_P050) antibody is Catalog # AAP57447 (Previous Catalog # AAPP41441)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD16
Uniprot ID Q68DU8
Protein Name BTB/POZ domain-containing protein KCTD16
Protein Accession # NP_065819
Purification Affinity Purified
Nucleotide Accession # NM_020768
Tested Species Reactivity Human
Gene Symbol KCTD16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-KCTD16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com