| Product Number |
ARP57446_P050 |
| Product Page |
www.avivasysbio.com/srgap1-antibody-middle-region-arp57446-p050.html |
| Name |
Srgap1 Antibody - middle region (ARP57446_P050) |
| Protein Size (# AA) |
714 amino acids |
| Molecular Weight |
80kDa |
| NCBI Gene Id |
117600 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SLIT-ROBO Rho GTPase activating protein 1 |
| Alias Symbols |
Arhg, Arhgap13, 4930572H05Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
Robo1; Cdc42; Rhoa; BMPR1B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Srgap1 (ARP57446_P050) antibody |
| Blocking Peptide |
For anti-Srgap1 (ARP57446_P050) antibody is Catalog # AAP57446 (Previous Catalog # AAPP41440) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q91Z69 |
| Protein Name |
SLIT-ROBO Rho GTPase-activating protein 1 |
| Protein Accession # |
AAL27030 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001081037 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Srgap1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Srgap1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
