RAB22A Antibody - middle region (ARP57434_P050)

• Product Number: ARP57434_P050
• Name: RAB22A Antibody - middle region (ARP57434_P050)
• Protein Size (# AA): 194 amino acids
• Molecular Weight: 22kDa
• NCBI Gene Id: 57403
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: RAB22A, member RAS oncogene family
• Alias Symbols: MGC16770
• Peptide Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
• Protein Interactions: APPL2; UBC; ATP6V1B1; RBSN; RAB3GAP1; RABGEF1; RAB5A; ELAVL1; SMURF2; EEA1; RABAC1; RAB7A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RAB22A (ARP57434_P050) antibody is Catalog # AAP57434 (Previous Catalog # AAPP41431)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A
• Uniprot ID: P35285
• Protein Name: Ras-related protein Rab-22A
• Publications:

  Rab22a controls MHC-I intracellular trafficking and antigen cross-presentation by dendritic cells. EMBO Rep. 17, 1753-1765 (2016). 27861124

• Sample Type Confirmation:

  RAB22A is strongly supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_065724
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020673
• Tested Species Reactivity: Human
• Gene Symbol: RAB22A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human MCF7
  
  WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/ml
  Positive Control: MCF7 cell lysateRAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells
• Image 2: Murin JAWS-II
  
  Lanes:
  Murin JAWS-II cells Primary Antibody Dilution:
  1:1000 Secondary Antibody:
  Anti-rabbit-FITC Secondary Antibody Dilution:
  1:1500 Gene Name:
  Blue: Nucleus Green: Rab22a Submitted by:
  RAB22A