PELI1 Antibody - N-terminal region (ARP57429_P050)

Data Sheet
 
Product Number ARP57429_P050
Product Page www.avivasysbio.com/peli1-antibody-n-terminal-region-arp57429-p050.html
Name PELI1 Antibody - N-terminal region (ARP57429_P050)
Protein Size (# AA) 418 amino acids
Molecular Weight 46kDa
NCBI Gene Id 57162
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pellino E3 ubiquitin protein ligase 1
Alias Symbols DKFZp686C18116, MGC50990
Peptide Sequence Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.
Protein Interactions UBC; VAC14; TRIP13; BCL6; SRPK2; SRPK1; DEAF1; IRAK1; UBE2V1; UBE2N; UBE2D2; UBE2D1; IRAK4; TRAF6; NR2C2; MYD88; SMAD6; IL1R1; TBK1; IKBKB; UBE2I; RIPK1; IRAK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PELI1 (ARP57429_P050) antibody
Blocking Peptide For anti-PELI1 (ARP57429_P050) antibody is Catalog # AAP57429 (Previous Catalog # AAPP41426)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1
Uniprot ID Q8C669
Protein Name E3 ubiquitin-protein ligase pellino homolog 1
Sample Type Confirmation

PELI1 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_065702
Purification Affinity Purified
Nucleotide Accession # NM_020651
Tested Species Reactivity Human
Gene Symbol PELI1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human 721_B
Host: Rabbit
Target Name: PELI1
Sample Type: Human 721_B
Antibody Dilution: 1.0ug/mlPELI1 is supported by BioGPS gene expression data to be expressed in 721_B
Image 2
Human HepG2
WB Suggested Anti-PELI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com