ACTR3B Antibody - N-terminal region (ARP57420_P050)

Data Sheet
 
Product Number ARP57420_P050
Product Page www.avivasysbio.com/actr3b-antibody-n-terminal-region-arp57420-p050.html
Name ACTR3B Antibody - N-terminal region (ARP57420_P050)
Protein Size (# AA) 418 amino acids
Molecular Weight 47kDa
NCBI Gene Id 57180
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ARP3 actin-related protein 3 homolog B (yeast)
Description
Alias Symbols ARP11, ARP3BETA
Peptide Sequence Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
Protein Interactions PAN2; EXOC5; UBC; RSRC1; ARPC3P1; ARPC5L; CCAR2; TWF2; ARPC1A; ARPC2; ACTR2; ARPC1B; ARPC3; ARPC4; ARPC5; CDK4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACTR3B (ARP57420_P050) antibody
Blocking Peptide For anti-ACTR3B (ARP57420_P050) antibody is Catalog # AAP57420 (Previous Catalog # AAPP41419)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B
Uniprot ID Q9P1U1
Protein Name Actin-related protein 3B
Publications

Induced Arp2/3 Complex Depletion Increases FMNL2/3 Formin Expression and Filopodia Formation. Front Cell Dev Biol. 9, 634708 (2021)

Protein Accession # NP_065178
Purification Affinity Purified
Nucleotide Accession # NM_020445
Tested Species Reactivity Human
Gene Symbol ACTR3B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human 721_B
WB Suggested Anti-ACTR3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com