PLSCR3 Antibody - middle region (ARP57395_P050)

Data Sheet
 
Product Number ARP57395_P050
Product Page https://www.avivasysbio.com/plscr3-antibody-middle-region-arp57395-p050.html
Name PLSCR3 Antibody - middle region (ARP57395_P050)
Protein Size (# AA) 295 amino acids
Molecular Weight 32kDa
NCBI Gene Id 57048
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Phospholipid scramblase 3
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr
Protein Interactions CATSPER1; TRIP13; STK16; UBC; ALG2; Nedd4; PLSCR1; PRKCD;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PLSCR3 (ARP57395_P050) antibody
Blocking Peptide For anti-PLSCR3 (ARP57395_P050) antibody is Catalog # AAP57395 (Previous Catalog # AAPP41332)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3
Uniprot ID Q9NRY6
Protein Name Phospholipid scramblase 3
Protein Accession # NP_065093
Purification Affinity Purified
Nucleotide Accession # NM_020360
Tested Species Reactivity Human
Gene Symbol PLSCR3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human Placenta
WB Suggested Anti-PLSCR3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta