Product Number |
ARP57395_P050 |
Product Page |
www.avivasysbio.com/plscr3-antibody-middle-region-arp57395-p050.html |
Name |
PLSCR3 Antibody - middle region (ARP57395_P050) |
Protein Size (# AA) |
295 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
57048 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Phospholipid scramblase 3 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr |
Protein Interactions |
CATSPER1; TRIP13; STK16; UBC; ALG2; Nedd4; PLSCR1; PRKCD; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PLSCR3 (ARP57395_P050) antibody |
Blocking Peptide |
For anti-PLSCR3 (ARP57395_P050) antibody is Catalog # AAP57395 (Previous Catalog # AAPP41332) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3 |
Uniprot ID |
Q9NRY6 |
Protein Name |
Phospholipid scramblase 3 |
Protein Accession # |
NP_065093 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020360 |
Tested Species Reactivity |
Human |
Gene Symbol |
PLSCR3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human Placenta
| WB Suggested Anti-PLSCR3 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Placenta |
|
|