Product Number |
ARP57393_P050-Biotin |
Product Page |
www.avivasysbio.com/pcnp-antibody-middle-region-biotin-arp57393-p050-biotin.html |
Name |
PCNP Antibody - middle region : Biotin (ARP57393_P050-Biotin) |
Protein Size (# AA) |
178 amino acids |
Molecular Weight |
19kDa |
Conjugation |
Biotin |
NCBI Gene Id |
57092 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
PEST proteolytic signal containing nuclear protein |
Alias Symbols |
DKFZp781I24156 |
Peptide Sequence |
Synthetic peptide located within the following region: AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
PCNP may be involved in cell cycle regulation. |
Protein Interactions |
HUWE1; UBC; BMI1; LMNA; CAND1; UHRF2; TERF2IP; ELAVL1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-PCNP (ARP57393_P050-Biotin) antibody |
Blocking Peptide |
For anti-PCNP (ARP57393_P050-Biotin) antibody is Catalog # AAP57393 (Previous Catalog # AAPP41330) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PCNP |
Uniprot ID |
Q5RCI9 |
Protein Name |
PEST proteolytic signal-containing nuclear protein |
Protein Accession # |
NP_065090 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020357 |
Gene Symbol |
PCNP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | |
|