PCNP Antibody - middle region : Biotin (ARP57393_P050-Biotin)

Data Sheet
 
Product Number ARP57393_P050-Biotin
Product Page www.avivasysbio.com/pcnp-antibody-middle-region-biotin-arp57393-p050-biotin.html
Name PCNP Antibody - middle region : Biotin (ARP57393_P050-Biotin)
Protein Size (# AA) 178 amino acids
Molecular Weight 19kDa
Conjugation Biotin
NCBI Gene Id 57092
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PEST proteolytic signal containing nuclear protein
Alias Symbols DKFZp781I24156
Peptide Sequence Synthetic peptide located within the following region: AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target PCNP may be involved in cell cycle regulation.
Protein Interactions HUWE1; UBC; BMI1; LMNA; CAND1; UHRF2; TERF2IP; ELAVL1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PCNP (ARP57393_P050-Biotin) antibody
Blocking Peptide For anti-PCNP (ARP57393_P050-Biotin) antibody is Catalog # AAP57393 (Previous Catalog # AAPP41330)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PCNP
Uniprot ID Q5RCI9
Protein Name PEST proteolytic signal-containing nuclear protein
Protein Accession # NP_065090
Purification Affinity Purified
Nucleotide Accession # NM_020357
Gene Symbol PCNP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com