PDXP Antibody - middle region (ARP57385_P050)

Data Sheet
 
Product Number ARP57385_P050
Product Page www.avivasysbio.com/pdxp-antibody-middle-region-arp57385-p050.html
Name PDXP Antibody - middle region (ARP57385_P050)
Protein Size (# AA) 296 amino acids
Molecular Weight 32 kDa
NCBI Gene Id 57026
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pyridoxal (pyridoxine, vitamin B6) phosphatase
Alias Symbols CIN, PLP, dJ37E16.5
Peptide Sequence Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gohla,A., (2005) Nat. Cell Biol. 7 (1), 21-29
Description of Target Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM].
Protein Interactions ARRB1; MED23; UBC; PDXP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PDXP (ARP57385_P050) antibody
Blocking Peptide For anti-PDXP (ARP57385_P050) antibody is Catalog # AAP57385 (Previous Catalog # AAPP35438)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PDXP
Uniprot ID Q96GD0
Protein Name Pyridoxal phosphate phosphatase
Protein Accession # NP_064711
Purification Affinity Purified
Nucleotide Accession # NM_020315
Tested Species Reactivity Human
Gene Symbol PDXP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com