Product Number |
ARP57385_P050 |
Product Page |
www.avivasysbio.com/pdxp-antibody-middle-region-arp57385-p050.html |
Name |
PDXP Antibody - middle region (ARP57385_P050) |
Protein Size (# AA) |
296 amino acids |
Molecular Weight |
32 kDa |
NCBI Gene Id |
57026 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Pyridoxal (pyridoxine, vitamin B6) phosphatase |
Alias Symbols |
CIN, PLP, dJ37E16.5 |
Peptide Sequence |
Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gohla,A., (2005) Nat. Cell Biol. 7 (1), 21-29 |
Description of Target |
Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM]. |
Protein Interactions |
ARRB1; MED23; UBC; PDXP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PDXP (ARP57385_P050) antibody |
Blocking Peptide |
For anti-PDXP (ARP57385_P050) antibody is Catalog # AAP57385 (Previous Catalog # AAPP35438) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PDXP |
Uniprot ID |
Q96GD0 |
Protein Name |
Pyridoxal phosphate phosphatase |
Protein Accession # |
NP_064711 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020315 |
Tested Species Reactivity |
Human |
Gene Symbol |
PDXP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
|