HMCES Antibody - N-terminal region (ARP57366_P050)

Data Sheet
 
Product Number ARP57366_P050
Product Page www.avivasysbio.com/hmces-antibody-n-terminal-region-arp57366-p050.html
Name HMCES Antibody - N-terminal region (ARP57366_P050)
Protein Size (# AA) 353 amino acids
Molecular Weight 39kDa
NCBI Gene Id 232210
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 5-hydroxymethylcytosine (hmC) binding, ES cell specific
Alias Symbols S, Srap1, C85376, 8430410A17Rik
Peptide Sequence Synthetic peptide located within the following region: SYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HMCES (ARP57366_P050) antibody
Blocking Peptide For anti-HMCES (ARP57366_P050) antibody is Catalog # AAP57366
Uniprot ID Q8R1M0
Protein Name embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
Protein Accession # NP_776098
Purification Affinity Purified
Nucleotide Accession # NM_173737
Tested Species Reactivity Mouse
Gene Symbol HMCES
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 100%; Rat: 93%
Image 1
Mouse Small Intestine
Host: Rabbit
Target Name: 8430410A17Rik
Sample Type: Mouse Small Intestine
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com