Product Number |
ARP57352_P050 |
Product Page |
www.avivasysbio.com/cyp26b1-antibody-middle-region-arp57352-p050.html |
Name |
CYP26B1 Antibody - middle region (ARP57352_P050) |
Protein Size (# AA) |
512 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
56603 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cytochrome P450, family 26, subfamily B, polypeptide 1 |
Alias Symbols |
RHFCA, CYP26A2, P450RAI2, P450RAI-2 |
Peptide Sequence |
Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid. |
Protein Interactions |
ELAVL1; NEDD4L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP26B1 (ARP57352_P050) antibody |
Blocking Peptide |
For anti-CYP26B1 (ARP57352_P050) antibody is Catalog # AAP57352 (Previous Catalog # AAPP41231) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CYP26B1 |
Uniprot ID |
Q9NR63 |
Protein Name |
Cytochrome P450 26B1 |
Protein Accession # |
NP_063938 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_019885 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP26B1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human ACHN
| WB Suggested Anti-CYP26B1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: ACHN cell lysate |
|
|