CYP26B1 Antibody - N-terminal region (ARP57351_P050)

Data Sheet
 
Product Number ARP57351_P050
Product Page www.avivasysbio.com/cyp26b1-antibody-n-terminal-region-arp57351-p050.html
Name CYP26B1 Antibody - N-terminal region (ARP57351_P050)
Protein Size (# AA) 512 amino acids
Molecular Weight 57kDa
NCBI Gene Id 56603
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cytochrome P450, family 26, subfamily B, polypeptide 1
Description
Alias Symbols RHFCA, CYP26A2, P450RAI2, P450RAI-2
Peptide Sequence Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.
Protein Interactions ELAVL1; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP26B1 (ARP57351_P050) antibody
Blocking Peptide For anti-CYP26B1 (ARP57351_P050) antibody is Catalog # AAP57351 (Previous Catalog # AAPP41230)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CYP26B1
Uniprot ID Q9NR63
Protein Name Cytochrome P450 26B1
Protein Accession # NP_063938
Purification Affinity Purified
Nucleotide Accession # NM_019885
Tested Species Reactivity Human
Gene Symbol CYP26B1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-CYP26B1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Fetal Brain
Host: Rabbit
Target Name: CYP26B1
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com