TUBA8 Antibody - N-terminal region : Biotin (ARP57298_P050-Biotin)

Data Sheet
 
Product Number ARP57298_P050-Biotin
Product Page www.avivasysbio.com/tuba8-antibody-n-terminal-region-biotin-arp57298-p050-biotin.html
Name TUBA8 Antibody - N-terminal region : Biotin (ARP57298_P050-Biotin)
Protein Size (# AA) 449 amino acids
Molecular Weight 50kDa
Conjugation Biotin
NCBI Gene Id 51807
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tubulin, alpha 8
Alias Symbols CDCBM8, TUBAL2
Peptide Sequence Synthetic peptide located within the following region: EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants.
Protein Interactions TP53; UBC; LGR4; rev; IGSF8; HDAC6; CD81; UBL4A; SHC1; ARRB2; PPP2CA; MEPCE; GRM7; PXN; SIAH1; MYC; TCP1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TUBA8 (ARP57298_P050-Biotin) antibody
Blocking Peptide For anti-TUBA8 (ARP57298_P050-Biotin) antibody is Catalog # AAP57298 (Previous Catalog # AAPP44646)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA8
Uniprot ID Q9NY65
Protein Name Tubulin alpha-8 chain
Protein Accession # NP_061816
Purification Affinity Purified
Nucleotide Accession # NM_018943
Gene Symbol TUBA8
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com