Product Number |
ARP57258_P050 |
Product Page |
www.avivasysbio.com/cenpn-antibody-middle-region-arp57258-p050.html |
Name |
CENPN Antibody - middle region (ARP57258_P050) |
Protein Size (# AA) |
353 amino acids |
Molecular Weight |
40 kDa |
NCBI Gene Id |
55839 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Centromere protein N |
Alias Symbols |
BM039, CENP-N, ICEN32, C16orf60 |
Peptide Sequence |
Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]). |
Protein Interactions |
UBC; CENPP; CENPL; CENPU; CENPO; CENPM; CENPH; CENPK; CENPN; CENPQ; CENPI; CENPA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-CENPN (ARP57258_P050) antibody |
Blocking Peptide |
For anti-CENPN (ARP57258_P050) antibody is Catalog # AAP57258 (Previous Catalog # AAPP44233) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CENPN |
Uniprot ID |
Q96H22 |
Sample Type Confirmation |
CENPN is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001094095 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001100625 |
Tested Species Reactivity |
Human |
Gene Symbol |
CENPN |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
IF, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79% |
Image 1 | DNA/ACA
| Sample Type : DNA/ACA |
|
Image 2 | Human Jurkat
| WB Suggested Anti-CENPN Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysateCENPN is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 3 | Huh-7
| Sample Type: Huh-7 Primary Antibody Dilution: 4 ug/ml Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml Gene Name: CENPN |
|
Image 4 | MCF7
| Sample Type: MCF7 Primary Antibody Dilution: 4 ug/ml Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml Gene Name: CENPN |
|