ALLC Antibody - N-terminal region : HRP (ARP57249_P050-HRP)

Data Sheet
 
Product Number ARP57249_P050-HRP
Product Page www.avivasysbio.com/allc-antibody-n-terminal-region-hrp-arp57249-p050-hrp.html
Name ALLC Antibody - N-terminal region : HRP (ARP57249_P050-HRP)
Protein Size (# AA) 391 amino acids
Molecular Weight 43kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 55821
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Allantoicase
Alias Symbols ALC
Peptide Sequence Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Description of Target Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ALLC (ARP57249_P050-HRP) antibody
Blocking Peptide For anti-ALLC (ARP57249_P050-HRP) antibody is Catalog # AAP57249 (Previous Catalog # AAPP41013)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC
Uniprot ID B4DY77
Protein Name Allantoicase, isoform CRA_a EMBL EAX01050.1
Protein Accession # NP_060906
Purification Affinity Purified
Nucleotide Accession # NM_018436
Gene Symbol ALLC
Predicted Species Reactivity Human, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 82%; Dog: 85%; Horse: 83%; Human: 100%; Rabbit: 85%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com