| Product Number |
ARP57249_P050 |
| Product Page |
www.avivasysbio.com/allc-antibody-n-terminal-region-arp57249-p050.html |
| Name |
ALLC Antibody - N-terminal region (ARP57249_P050) |
| Protein Size (# AA) |
391 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
55821 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Allantoicase |
| Alias Symbols |
ALC |
| Peptide Sequence |
Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALLC (ARP57249_P050) antibody |
| Blocking Peptide |
For anti-ALLC (ARP57249_P050) antibody is Catalog # AAP57249 (Previous Catalog # AAPP41013) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC |
| Uniprot ID |
B4DY77 |
| Protein Name |
Allantoicase, isoform CRA_a EMBL EAX01050.1 |
| Protein Accession # |
NP_060906 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018436 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALLC |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 82%; Dog: 85%; Horse: 83%; Human: 100%; Rabbit: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ALLC Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
