| Product Number |
ARP57204_P050 |
| Product Page |
www.avivasysbio.com/pi4k2b-antibody-middle-region-arp57204-p050.html |
| Name |
PI4K2B Antibody - middle region (ARP57204_P050) |
| Protein Size (# AA) |
481 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
55300 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Phosphatidylinositol 4-kinase type 2 beta |
| Alias Symbols |
PIK42B, PI4KIIB |
| Peptide Sequence |
Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules. PIP itself may also have direct functional and s |
| Protein Interactions |
UBC; ELAVL1; AKT1; HSP90AA1; MAPK14; CASR; CD247; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PI4K2B (ARP57204_P050) antibody |
| Blocking Peptide |
For anti-PI4K2B (ARP57204_P050) antibody is Catalog # AAP57204 (Previous Catalog # AAPP40911) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PI4K2B |
| Uniprot ID |
Q8TCG2 |
| Protein Name |
Phosphatidylinositol 4-kinase type 2-beta |
| Protein Accession # |
NP_060793 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018323 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PI4K2B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 93% |
| Image 1 | Human 721_B
 | WB Suggested Anti-PI4K2B Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate |
|
|
